General Information

  • ID:  hor004563
  • Uniprot ID:  C0HKU0
  • Protein name:  Neuropeptide IMFamide
  • Gene name:  NA
  • Organism:  Agrotis ipsilon (Black cutworm moth)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  Expressed in corpora cardiaca (CC), corpora allata (CA), antennal lobe (AL) and gnathal ganglion (GNG) (at protein level). Expression detected in only a few animals (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrotis (genus), Noctuini (tribe), Noctuinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NYKNAPMNGIMF
  • Length:  12
  • Propeptide:  MMRFTIGVVCLVAVLLSLAEVSEANYKNAPMNGIMFGKRGPTEYDQRGKTFTALCEIATEACQAWFPSTENK
  • Signal peptide:  MMRFTIGVVCLVAVLLSLAEVSEA
  • Modification:  T12 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HKU0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004563_AF2.pdbhor004563_ESM.pdb

Physical Information

Mass: 159603 Formula: C62H94N16O17S2
Absent amino acids: CDEHLQRSTVW Common amino acids: N
pI: 9.3 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -40 Boman Index: -1026
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 40.83
Instability Index: -66.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  29466015
  • Title:  Mating-induced differential peptidomics of neuropeptides and protein hormones in Agrotis ipsilon moths.